Pulse.nl valuation and analysis

Robots.txt Information
Robot Path Permission
GoogleBot /
BingBot /
BaiduSpider /
YandexBot /
Meta Tags
Title Fellowmind | Expert in Microsoft Dynamics 365, Cloud & Data
Description Fellowmind is Europees expert op het vlak van Microsoft Business Applications, Cloud Infrastructure, Data & Analytics en Modern Workplace. Kom in contact!
Keywords N/A
Server Information
WebSite pulse favicon www.pulse.nl
Host IP 217.114.94.2
Location Sweden
Related Websites
Site Rank
More to Explore
pwntunes.net
qnet.hk
ramanandtours.com
repsolsinopecuk.com
rkr-hydraulika.cz
sleekeagle.github.io
slrprint.com
sonysab.in
spacim.co.in
srikanchimahaswamividyamandir.org
championslot.info
chaisouthafrica.com
Pulse.nl Valuation
US$5,812
Last updated: Dec 8, 2022

Pulse.nl has global traffic rank of 14,438,916. Pulse.nl has an estimated worth of US$ 5,812, based on its estimated Ads revenue. Pulse.nl receives approximately 212 unique visitors each day. Its web server is located in Sweden, with IP address 217.114.94.2. According to SiteAdvisor, pulse.nl is safe to visit.

Traffic & Worth Estimates
Purchase/Sale Value US$5,812
Daily Ads Revenue US$3
Monthly Ads Revenue US$95
Yearly Ads Revenue US$1,162
Daily Unique Visitors 212
Note: All traffic and earnings values are estimates.
Traffic Ranks
Global Rank 14,438,916
Delta (90 Days) 0
Most Popular In Country N/A
Country Rank N/A
DNS Records
Host Type TTL Data
pulse.nl A 3600 IP: 217.114.94.2
pulse.nl MX 3600 Priority: 10
Target: pulse-nl.mail.protection.outlook.com.
pulse.nl NS 3600 Target: ns3.systemec.nl.
pulse.nl NS 3600 Target: ns.systemec.nl.
pulse.nl NS 3600 Target: ns4.systemec.nl.
pulse.nl NS 3600 Target: ns2.systemec.nl.
pulse.nl TXT 300 TXT: 0l9VdTX/VmW+k/cOEVcu6hLAnxuLxpshdzW5n6UbQghK4trKtQU6EYCwq+0kpf4hFgAkcjjlJM6qRXmfW3kw/Q==
pulse.nl TXT 300 TXT: v=spf1 mx a:webmail.pulse.nl a:webmail.systemec.nl a:sisim1.systemec.nl a:sisim2.systemec.nl include:spf.afas.online include:spf.protection.outlook.com -all
pulse.nl TXT 300 TXT: d365mktkey=ncuHzjInlDaqnpILm52SpxvJOV8yLqRrbmFsDzCkOB4x
pulse.nl TXT 300 TXT: MS=ms35974856
pulse.nl SOA 3600 MNAME: ns.systemec.nl.
RNAME: postmaster.pulse.nl.
Serial: 2022040402
Refresh: 28800
Retry: 7200
Expire: 604800
Minimum TTL: 3600
HTTP Headers
HTTP/1.1 301 Moved Permanently
Date: Thu, 08 Dec 2022 16:17:52 GMT
Content-Length: 0
Connection: keep-alive
Location: https://www.pulse.nl/
Server: cloudflare
CF-RAY: 7766d04c1f598c4b-EWR

HTTP/2 301 
date: Thu, 08 Dec 2022 16:17:52 GMT
content-type: text/html; charset=utf-8
content-length: 163
location: https://www.fellowmindcompany.com/nl-nl/
access-control-allow-headers: *
set-cookie: ARRAffinity=a414bd23a92636b89f4e20ebeb18088a2b699635c579259303c6eb826f900246;Path=/;HttpOnly;Secure;Domain=www.pulse.nl
x-content-type-options: nosniff
x-xss-protection: 1; mode=block
x-frame-options: SAMEORIGIN
set-cookie: ARRAffinitySameSite=a414bd23a92636b89f4e20ebeb18088a2b699635c579259303c6eb826f900246;Path=/;HttpOnly;SameSite=None;Secure;Domain=www.pulse.nl
cf-cache-status: DYNAMIC
server: cloudflare
cf-ray: 7766d04eefc19e02-EWR

HTTP/2 200 
date: Thu, 08 Dec 2022 16:17:53 GMT
content-type: text/html; charset=utf-8
access-control-allow-headers: *
cache-control: private
set-cookie: ASP.NET_SessionId=bs0aznl2zlhh1120oyfnzfew; path=/; HttpOnly; SameSite=Lax
vary: Accept-Encoding
x-content-type-options: nosniff
x-xss-protection: 1; mode=block
x-frame-options: SAMEORIGIN
set-cookie: ARRAffinity=68664bb4e4f8e13df1cac1ade07e5562a4e870f346f4ac7d5a28e2a5327a30c8;Path=/;HttpOnly;Secure;Domain=www.fellowmindcompany.com
set-cookie: ARRAffinitySameSite=68664bb4e4f8e13df1cac1ade07e5562a4e870f346f4ac7d5a28e2a5327a30c8;Path=/;HttpOnly;SameSite=None;Secure;Domain=www.fellowmindcompany.com
cf-cache-status: DYNAMIC
server: cloudflare
cf-ray: 7766d050e9e11988-EWR

Pulse.nl Whois Information
Domain name: pulse.nl
Status:      active

Registrar:
   Systemec B.V.
   Marinus Dammeweg 25
   5928PW Venlo
   Netherlands

Abuse Contact:
   +31.773967572
   abuse@systemec.nl

Creation Date: 1996-10-14

Updated Date: 2019-11-21

DNSSEC:      yes

Domain nameservers:
   ns.systemec.nl
   ns3.systemec.nl
   ns2.systemec.nl
   ns4.systemec.nl

Record maintained by: NL Domain Registry

Copyright notice
No part of this publication may be reproduced, published, stored in a
retrieval system, or transmitted, in any form or by any means,
electronic, mechanical, recording, or otherwise, without prior
permission of the Foundation for Internet Domain Registration in the
Netherlands (SIDN).
These restrictions apply equally to registrars, except in that
reproductions and publications are permitted insofar as they are
reasonable, necessary and solely in the context of the registration
activities referred to in the General Terms and Conditions for .nl
Registrars.
Any use of this material for advertising, targeting commercial offers or
similar activities is explicitly forbidden and liable to result in legal
action. Anyone who is aware or suspects that such activities are taking
place is asked to inform the Foundation for Internet Domain Registration
in the Netherlands.
(SIDN) Dutch Copyright Act, protection of authors' rights (Section 10,
subsection 1, clause 1).